Lineage for d4lnya1 (4lny A:2-246)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) 
Protein automated matches [190053] (10 species)
not a true protein
Species Artificial gene [TaxId:32630] [188991] (9 PDB entries) 
Domain d4lnya1: 4lny A:2-246 [224721]
Other proteins in same PDB: d4lnya2
automated match to d3tc7a_
complexed with cd, cl
Details for d4lnya1
PDB Entry: 4lny (more details), 1.93 Å
PDB Description: Crystal Structure of Engineered Protein, Northeast Structural Genomics Consortium Target OR422
PDB Compounds: (A:) Engineered Protein OR422SCOPe Domain Sequences for d4lnya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnya1 c.1.2.4 (A:2-246) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiaeykrkdpsgld
verdpieyakfmeryavglfisteekyfngsyetlrkiassvsipilmydfivkesqidd
aynlgadtvalivkiltereleslleyarsygmepliiindendldialrigarfigiaa
rdwetgeinkenqrklismipsnvvkvakegiserneieelrklgvnafvtasgslmrnp
ekike
SCOPe Domain Coordinates for d4lnya1:
Click to download the PDB-style file with coordinates for d4lnya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4lnya1:
- d4lnya1 first appeared in SCOPe 2.03, called d4lnya_
- d4lnya1 appears in SCOPe 2.07
View in 3D
