SCOPe 2.04: Domain d4ln1d2: 4ln1 D:148-314

Lineage for d4ln1d2 (4ln1 D:148-314)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (24 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [226735] (2 PDB entries)

8. Domain d4ln1d2: 4ln1 D:148-314 [224719]
   Other proteins in same PDB: d4ln1a1, d4ln1b1, d4ln1c1, d4ln1d1
   automated match to d2ldba2
   complexed with ca

Details for d4ln1d2

PDB Entry: 4ln1, 1.9 Å

PDB Description: crystal structure of l-lactate dehydrogenase from bacillus cereus atcc 14579 complexed with calcium, nysgrc target 029452

PDB Compounds: (D:) L-lactate dehydrogenase 1

SCOPe Domain Sequences for d4ln1d2:

Sequence; same for both SEQRES and ATOM records:

>d4ln1d2 d.162.1.0 (D:148-314) automated matches {Bacillus cereus [TaxId: 226900]}
ttldsarfrymlgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntyn
qedldkifinvrdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygq
kdvyigvpavlnrggvreilevelsedeelkfdhsvqvlketmapvl

Timeline for d4ln1d2:

• d4ln1d2 first appeared in SCOPe 2.03
  
• d4ln1d2 appears in SCOPe 2.05
  
• d4ln1d2 appears in the current release, SCOPe 2.08