Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [226735] (2 PDB entries) |
Domain d4ln1d2: 4ln1 D:148-314 [224719] Other proteins in same PDB: d4ln1a1, d4ln1b1, d4ln1c1, d4ln1d1 automated match to d2ldba2 complexed with ca |
PDB Entry: 4ln1 (more details), 1.9 Å
SCOPe Domain Sequences for d4ln1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ln1d2 d.162.1.0 (D:148-314) automated matches {Bacillus cereus [TaxId: 226900]} ttldsarfrymlgeyfdigphnihayiigehgdtelpvwshvsvgiqklqtllekdntyn qedldkifinvrdaayhiierkgatyygigmsllrvtkailndensvltvsaylegqygq kdvyigvpavlnrggvreilevelsedeelkfdhsvqvlketmapvl
Timeline for d4ln1d2: