Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Bacillus cereus [TaxId:226900] [189455] (5 PDB entries) |
Domain d4ln1b1: 4ln1 B:1-147 [224714] Other proteins in same PDB: d4ln1a2, d4ln1a3, d4ln1b2, d4ln1b3, d4ln1c2, d4ln1c3, d4ln1d2, d4ln1d3 automated match to d1ldna1 complexed with ca |
PDB Entry: 4ln1 (more details), 1.9 Å
SCOPe Domain Sequences for d4ln1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ln1b1 c.2.1.0 (B:1-147) automated matches {Bacillus cereus [TaxId: 226900]} mkkginrvvlvgtgavgcsyaycminqavaeefvlvdvneakaegeamdlshavpfapap trvwkgsyedckdadlvvitaglpqkpgetrldlveknakifkqivrsimdsgfdgifli atnpvdiltyvtwkesglpkervigsg
Timeline for d4ln1b1: