Lineage for d4lmqi1 (4lmq I:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296662Domain d4lmqi1: 4lmq I:1-107 [224708]
    Other proteins in same PDB: d4lmqd_, d4lmqf_, d4lmqi2, d4lmql2
    automated match to d1rhha1

Details for d4lmqi1

PDB Entry: 4lmq (more details), 2.77 Å

PDB Description: development and preclinical characterization of a humanized antibody targeting cxcl12
PDB Compounds: (I:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d4lmqi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmqi1 b.1.1.0 (I:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasesisyslswyqqkpgkapklliynavklesgvps
rfsgsgsgtdftltisslqpedfatyyckqywntpftfgqgtkveik

SCOPe Domain Coordinates for d4lmqi1:

Click to download the PDB-style file with coordinates for d4lmqi1.
(The format of our PDB-style files is described here.)

Timeline for d4lmqi1: