Lineage for d4lmqf_ (4lmq F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635819Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1635820Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1635821Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1636086Protein automated matches [190403] (2 species)
    not a true protein
  7. 1636087Species Human (Homo sapiens) [TaxId:9606] [187277] (22 PDB entries)
  8. 1636116Domain d4lmqf_: 4lmq F: [224707]
    Other proteins in same PDB: d4lmqi1, d4lmqi2, d4lmql1, d4lmql2
    automated match to d3hp3f_

Details for d4lmqf_

PDB Entry: 4lmq (more details), 2.77 Å

PDB Description: development and preclinical characterization of a humanized antibody targeting cxcl12
PDB Compounds: (F:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d4lmqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmqf_ d.9.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeyleka

SCOPe Domain Coordinates for d4lmqf_:

Click to download the PDB-style file with coordinates for d4lmqf_.
(The format of our PDB-style files is described here.)

Timeline for d4lmqf_: