SCOPe 2.08: Domain d4lmqd_: 4lmq D:

Lineage for d4lmqd_ (4lmq D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54151] (21 PDB entries)

8. Domain d4lmqd_: 4lmq D: [224706]
   Other proteins in same PDB: d4lmqe_, d4lmqh_, d4lmqi1, d4lmqi2, d4lmql1, d4lmql2
   automated match to d3hp3f_

Details for d4lmqd_

PDB Entry: 4lmq, 2.77 Å

PDB Description: development and preclinical characterization of a humanized antibody targeting cxcl12

PDB Compounds: (D:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d4lmqd_:

Sequence, based on SEQRES records:

>d4lmqd_ d.9.1.1 (D:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
crffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylekalnk

Sequence, based on observed residues (ATOM records):

>d4lmqd_ d.9.1.1 (D:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
crffeshvaranvkhlkilntplqivarlknnnrqvcidpklkwiqeylekalnk

Timeline for d4lmqd_:

• d4lmqd_ first appeared in SCOPe 2.03
  
• d4lmqd_ appears in SCOPe 2.07