![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) ![]() |
![]() | Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) |
![]() | Protein Cytochrome f, large domain [49443] (5 species) this domain is interrupted by a small domain which is barrel-sandwich hybrid fold |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries) |
![]() | Domain d1e2vc1: 1e2v C:601-768,C:833-851 [22470] Other proteins in same PDB: d1e2va2, d1e2vb2, d1e2vc2 complexed with act, hec; mutant |
PDB Entry: 1e2v (more details), 1.85 Å
SCOPe Domain Sequences for d1e2vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2vc1 b.2.6.1 (C:601-768,C:833-851) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnnXnvggfgqaete ivlqnpar
Timeline for d1e2vc1:
![]() Domains from other chains: (mouse over for more information) d1e2va1, d1e2va2, d1e2vb1, d1e2vb2 |