SCOPe 2.07: Domain d4lkca2: 4lkc A:109-214

Lineage for d4lkca2 (4lkc A:109-214)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4lkca2: 4lkc A:109-214 [224695]
   Other proteins in same PDB: d4lkca1
   automated match to d1rhha2

Details for d4lkca2

PDB Entry: 4lkc, 2.2 Å

PDB Description: An Antibody Against the C-terminal Domain of PCSK9 lowers LDL Cholesterol Levels in vivo

PDB Compounds: (A:) Fab fragment of PCSK9 antibody

SCOPe Domain Sequences for d4lkca2:

Sequence; same for both SEQRES and ATOM records:

>d4lkca2 b.1.1.2 (A:109-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4lkca2:

• d4lkca2 first appeared in SCOPe 2.03
  
• d4lkca2 appears in SCOPe 2.06
  
• d4lkca2 appears in the current release, SCOPe 2.08