Lineage for d4lkca1 (4lkc A:2-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765661Domain d4lkca1: 4lkc A:2-108 [224694]
    Other proteins in same PDB: d4lkca2
    automated match to d1rhha1

Details for d4lkca1

PDB Entry: 4lkc (more details), 2.2 Å

PDB Description: An Antibody Against the C-terminal Domain of PCSK9 lowers LDL Cholesterol Levels in vivo
PDB Compounds: (A:) Fab fragment of PCSK9 antibody

SCOPe Domain Sequences for d4lkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkca1 b.1.1.0 (A:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aiqltqspsslsasvgdrvtitcrasqgissalawyqqkpgkapklliydasslesgvps
rfsgsgsgtdftltisslqpedfatyycqqfnsylitfgqgtrleik

SCOPe Domain Coordinates for d4lkca1:

Click to download the PDB-style file with coordinates for d4lkca1.
(The format of our PDB-style files is described here.)

Timeline for d4lkca1: