Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
Domain d4lkca1: 4lkc A:2-108 [224694] Other proteins in same PDB: d4lkca2 automated match to d1rhha1 |
PDB Entry: 4lkc (more details), 2.2 Å
SCOPe Domain Sequences for d4lkca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lkca1 b.1.1.0 (A:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]} aiqltqspsslsasvgdrvtitcrasqgissalawyqqkpgkapklliydasslesgvps rfsgsgsgtdftltisslqpedfatyycqqfnsylitfgqgtrleik
Timeline for d4lkca1: