Lineage for d4ljxa_ (4ljx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692925Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 2692926Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 2692942Protein automated matches [190579] (2 species)
    not a true protein
  7. 2692945Species Human (Homo sapiens) [TaxId:9606] [187581] (4 PDB entries)
  8. 2692948Domain d4ljxa_: 4ljx A: [224686]
    automated match to d1kqqa_

Details for d4ljxa_

PDB Entry: 4ljx (more details), 2.21 Å

PDB Description: crystal structure of an at-rich interactive domain-containing protein 3a (arid3a) from homo sapiens at 2.21 a resolution
PDB Compounds: (A:) AT-rich interactive domain-containing protein 3A

SCOPe Domain Sequences for d4ljxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ljxa_ a.4.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wtyeeqfkqlyeldgdpkrkeflddlfsfmqkrgtpvnripimakqvldlfmlyvlvtek
gglvevinkklwreitkglnlptsitsaaftlrtqymeylypyecekrglsnpnelqaai
ds

SCOPe Domain Coordinates for d4ljxa_:

Click to download the PDB-style file with coordinates for d4ljxa_.
(The format of our PDB-style files is described here.)

Timeline for d4ljxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ljxb_