Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.3: ARID-like [46774] (2 families) contains extra helices at both N- and C-termini |
Family a.4.3.1: ARID domain [46775] (5 proteins) |
Protein automated matches [190579] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187581] (4 PDB entries) |
Domain d4ljxa_: 4ljx A: [224686] automated match to d1kqqa_ |
PDB Entry: 4ljx (more details), 2.21 Å
SCOPe Domain Sequences for d4ljxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ljxa_ a.4.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wtyeeqfkqlyeldgdpkrkeflddlfsfmqkrgtpvnripimakqvldlfmlyvlvtek gglvevinkklwreitkglnlptsitsaaftlrtqymeylypyecekrglsnpnelqaai ds
Timeline for d4ljxa_: