| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
| Protein automated matches [190903] (22 species) not a true protein |
| Species Coryneform bacterium [TaxId:1728] [189898] (4 PDB entries) |
| Domain d4lhpi_: 4lhp I: [224681] automated match to d3mjza_ complexed with po4, so4 |
PDB Entry: 4lhp (more details), 2.02 Å
SCOPe Domain Sequences for d4lhpi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhpi_ d.80.1.0 (I:) automated matches {Coryneform bacterium [TaxId: 1728]}
pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
aqyvtgelaip
Timeline for d4lhpi_: