Lineage for d1e2va1 (1e2v A:1-168,A:233-251)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55488Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 55489Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 55490Protein Cytochrome f, large domain [49443] (3 species)
  7. 55491Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (5 PDB entries)
  8. 55494Domain d1e2va1: 1e2v A:1-168,A:233-251 [22468]
    Other proteins in same PDB: d1e2va2, d1e2vb2, d1e2vc2

Details for d1e2va1

PDB Entry: 1e2v (more details), 1.85 Å

PDB Description: N153Q mutant of cytochrome f from Chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2va1 b.2.6.1 (A:1-168,A:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggqrgrgqvypdgkksnnXnvggfgqaete
ivlqnpar

SCOP Domain Coordinates for d1e2va1:

Click to download the PDB-style file with coordinates for d1e2va1.
(The format of our PDB-style files is described here.)

Timeline for d1e2va1: