Lineage for d4lhpf_ (4lhp F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1421487Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1421488Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1421849Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 1421850Protein automated matches [190903] (15 species)
    not a true protein
  7. 1421867Species Coryneform bacterium [TaxId:1728] [189898] (4 PDB entries)
  8. 1421873Domain d4lhpf_: 4lhp F: [224678]
    automated match to d3mjza_
    complexed with po4, so4

Details for d4lhpf_

PDB Entry: 4lhp (more details), 2.02 Å

PDB Description: Crystal Structure of Native FG41Malonate Semialdehyde Decarboxylase
PDB Compounds: (F:) FG41 Malonate Semialdehyde Decarboxylase

SCOPe Domain Sequences for d4lhpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhpf_ d.80.1.0 (F:) automated matches {Coryneform bacterium [TaxId: 1728]}
pliridltsdrsreqrraiadavhdalvevlaipardrfqiltahdpsdiiaedaglgfq
rspsvviihvftqagrtietkqrvfaaiteslapigvagsdvfiaitenaphdwsfgfgs
aqyvtgelai

SCOPe Domain Coordinates for d4lhpf_:

Click to download the PDB-style file with coordinates for d4lhpf_.
(The format of our PDB-style files is described here.)

Timeline for d4lhpf_: