Lineage for d1e2wb1 (1e2w B:1-168,B:233-251)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 105991Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 106171Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 106172Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 106173Protein Cytochrome f, large domain [49443] (3 species)
  7. 106174Species Chlamydomonas reinhardtii [TaxId:3055] [49445] (5 PDB entries)
  8. 106176Domain d1e2wb1: 1e2w B:1-168,B:233-251 [22467]
    Other proteins in same PDB: d1e2wa2, d1e2wb2

Details for d1e2wb1

PDB Entry: 1e2w (more details), 1.6 Å

PDB Description: n168f mutant of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1e2wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2wb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Chlamydomonas reinhardtii}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnfXnvggfgqaete
ivlqnpar

SCOP Domain Coordinates for d1e2wb1:

Click to download the PDB-style file with coordinates for d1e2wb1.
(The format of our PDB-style files is described here.)

Timeline for d1e2wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e2wb2