Lineage for d1e2wb1 (1e2w B:1-168,B:233-251)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768468Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2768469Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2768470Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2768471Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [49445] (6 PDB entries)
  8. 2768473Domain d1e2wb1: 1e2w B:1-168,B:233-251 [22467]
    Other proteins in same PDB: d1e2wa2, d1e2wb2
    complexed with hec; mutant

Details for d1e2wb1

PDB Entry: 1e2w (more details), 1.6 Å

PDB Description: n168f mutant of cytochrome f from chlamydomonas reinhardtii
PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1e2wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2wb1 b.2.6.1 (B:1-168,B:233-251) Cytochrome f, large domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ypvfaqqnyanpreangrivcanchlaqkaveievpqavlpdtvfeavielpydkqvkqv
langkkgdlnvgmvlilpegfelappdrvpaeikekvgnlyyqpyspeqknilvvgpvpg
kkysemvvpilspdpaknknvsylkypiyfggnrgrgqvypdgkksnfXnvggfgqaete
ivlqnpar

SCOPe Domain Coordinates for d1e2wb1:

Click to download the PDB-style file with coordinates for d1e2wb1.
(The format of our PDB-style files is described here.)

Timeline for d1e2wb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e2wb2