Lineage for d4lgub1 (4lgu B:254-346)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589206Protein automated matches [190700] (1 species)
    not a true protein
  7. 2589207Species Human (Homo sapiens) [TaxId:9606] [187840] (46 PDB entries)
  8. 2589242Domain d4lgub1: 4lgu B:254-346 [224667]
    Other proteins in same PDB: d4lgub2
    automated match to d3mupc_
    complexed with 1yh, zn

Details for d4lgub1

PDB Entry: 4lgu (more details), 2 Å

PDB Description: crystal structure of clap1 bir3 bound to t3226692
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4lgub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lgub1 g.52.1.1 (B:254-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgry

SCOPe Domain Coordinates for d4lgub1:

Click to download the PDB-style file with coordinates for d4lgub1.
(The format of our PDB-style files is described here.)

Timeline for d4lgub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lgub2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lgua_