SCOPe 2.03: Domain d4lgua_: 4lgu A:

Lineage for d4lgua_ (4lgu A:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (21 PDB entries)

8. Domain d4lgua_: 4lgu A: [224666]
   automated match to d3mupc_
   complexed with 1yh, zn

Details for d4lgua_

PDB Entry: 4lgu, 2 Å

PDB Description: crystal structure of clap1 bir3 bound to t3226692

PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4lgua_:

Sequence; same for both SEQRES and ATOM records:

>d4lgua_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry

Timeline for d4lgua_:

• d4lgua_ is new in SCOPe 2.03-stable
  
• d4lgua_ appears in SCOPe 2.04
  
• d4lgua_ appears in the current release, SCOPe 2.08