Lineage for d4lera_ (4ler A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1746069Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1746290Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 1746291Protein automated matches [191037] (10 species)
    not a true protein
  7. 1746311Species Bacteroides vulgatus [TaxId:435590] [226723] (1 PDB entry)
  8. 1746312Domain d4lera_: 4ler A: [224659]
    automated match to d3ejna1
    complexed with cl

Details for d4lera_

PDB Entry: 4ler (more details), 1.42 Å

PDB Description: crystal structure of a putative outer membrane protein, probably involved in nutrient binding (bvu_1254) from bacteroides vulgatus atcc 8482 at 1.42 a resolution
PDB Compounds: (A:) Putative outer membrane protein, probably involved in nutrient binding

SCOPe Domain Sequences for d4lera_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lera_ a.118.8.0 (A:) automated matches {Bacteroides vulgatus [TaxId: 435590]}
tnpsllltgvaysafnqtssdachaakmliltsgeskyqvykwtrgdfdyysnlrdvtkm
seeagegsayqalahffranyfyqltldfgsipytdalkaetdanyqpaydsqevvlagi
lkeleeadkmlegsdeiisgdiiyngnlvnwrklinayrlrilmslsgkekvgdidvkse
fskivadgplmeslsdngqliyldqqdnrypyfndsdfgsgrfmdstyiaelatrqdprl
favatqtpnaekagkaindfssydggdpavpyslvndkavagncskpapryyqtptnepm
vllgyveqqlilaeavvrgwiqgddkiyyesavkasfefyqkyavsvadyltqdaaaeyl
rndkvayssslstdekieriimqkylptflqgsvwlpyyealrtgypdfrraagvslpyr
wmypqdeynnnathveaalneqfggsdktsdkpwwlq

SCOPe Domain Coordinates for d4lera_:

Click to download the PDB-style file with coordinates for d4lera_.
(The format of our PDB-style files is described here.)

Timeline for d4lera_: