SCOPe 2.08: Domain d4leob2: 4leo B:114-219

Lineage for d4leob2 (4leo B:114-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4leob2: 4leo B:114-219 [224658]
   Other proteins in same PDB: d4leoa_, d4leob1
   automated match to d1rhha2
   complexed with nag

Details for d4leob2

PDB Entry: 4leo, 2.64 Å

PDB Description: crystal structure of anti-her3 fab rg7116 in complex with the extracellular domains of human her3 (erbb3)

PDB Compounds: (B:) RG7116 Fab light chain

SCOPe Domain Sequences for d4leob2:

Sequence; same for both SEQRES and ATOM records:

>d4leob2 b.1.1.2 (B:114-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4leob2:

• d4leob2 first appeared in SCOPe 2.03
  
• d4leob2 appears in SCOPe 2.07