Lineage for d4leob1 (4leo B:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760612Domain d4leob1: 4leo B:1-113 [224657]
    Other proteins in same PDB: d4leob2
    automated match to d1rhha1
    complexed with nag

Details for d4leob1

PDB Entry: 4leo (more details), 2.64 Å

PDB Description: crystal structure of anti-her3 fab rg7116 in complex with the extracellular domains of human her3 (erbb3)
PDB Compounds: (B:) RG7116 Fab light chain

SCOPe Domain Sequences for d4leob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4leob1 b.1.1.0 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspdslavslgeratinckssqsvlnsgnqknyltwyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqsdysypytfgqgtkleik

SCOPe Domain Coordinates for d4leob1:

Click to download the PDB-style file with coordinates for d4leob1.
(The format of our PDB-style files is described here.)

Timeline for d4leob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4leob2
View in 3D
Domains from other chains:
(mouse over for more information)
d4leoa_