Lineage for d4ldna1 (4ldn A:1-238)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2888846Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2888847Protein automated matches [190781] (46 species)
    not a true protein
  7. 2889272Species Vibrio fischeri [TaxId:312309] [226714] (4 PDB entries)
  8. 2889274Domain d4ldna1: 4ldn A:1-238 [224656]
    Other proteins in same PDB: d4ldna2
    automated match to d2iscf_
    complexed with edo, po4

Details for d4ldna1

PDB Entry: 4ldn (more details), 1.48 Å

PDB Description: crystal structure of a putative purine nucleoside phosphorylase from vibrio fischeri es114 (target nysgrc-029521)
PDB Compounds: (A:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4ldna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldna1 c.56.2.0 (A:1-238) automated matches {Vibrio fischeri [TaxId: 312309]}
mstphinapldafadtilmpgdplrakliaetylenvvqvtdvrgmlgftgefkgrkisv
mghgmgapsasiyfhelmttykvknfirigscgaihddvklkdlivaigastdskmnrir
fkdndfaatanynmlsecvntlkttdinylvgnvfssdlfyrpdeeqydmmarygilgve
mevnalysaaaenhcnavalctvtdhiknhehltaderrtelheminvaldvalklpt

SCOPe Domain Coordinates for d4ldna1:

Click to download the PDB-style file with coordinates for d4ldna1.
(The format of our PDB-style files is described here.)

Timeline for d4ldna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ldna2