SCOPe 2.03: Domain d4ldfb_: 4ldf B:

Lineage for d4ldfb_ (4ldf B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [224846] (1 PDB entry)

8. Domain d4ldfb_: 4ldf B: [224655]
   automated match to d1e6ia_
   complexed with gol, unx

Details for d4ldfb_

PDB Entry: 4ldf, 2 Å

PDB Description: crystal structure of cpbrd2 from cryptosporidium, cgd3_3190

PDB Compounds: (B:) GCN5 like acetylase + bromodomain

SCOPe Domain Sequences for d4ldfb_:

Sequence; same for both SEQRES and ATOM records:

>d4ldfb_ a.29.2.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
vdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkeyk
tlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe

Timeline for d4ldfb_:

• d4ldfb_ is new in SCOPe 2.03-stable
  
• d4ldfb_ appears in SCOPe 2.04
  
• d4ldfb_ appears in the current release, SCOPe 2.08