![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
![]() | Protein automated matches [190615] (15 species) not a true protein |
![]() | Species Cryptosporidium parvum [TaxId:353152] [224846] (2 PDB entries) |
![]() | Domain d4ldfb_: 4ldf B: [224655] automated match to d1e6ia_ complexed with gol, unx |
PDB Entry: 4ldf (more details), 2 Å
SCOPe Domain Sequences for d4ldfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldfb_ a.29.2.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]} vdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkeyk tlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe
Timeline for d4ldfb_: