Lineage for d4ldfa_ (4ldf A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1487792Species Cryptosporidium parvum [TaxId:353152] [224846] (1 PDB entry)
  8. 1487793Domain d4ldfa_: 4ldf A: [224654]
    automated match to d1e6ia_
    complexed with gol, unx

Details for d4ldfa_

PDB Entry: 4ldf (more details), 2 Å

PDB Description: crystal structure of cpbrd2 from cryptosporidium, cgd3_3190
PDB Compounds: (A:) GCN5 like acetylase + bromodomain

SCOPe Domain Sequences for d4ldfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ldfa_ a.29.2.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
kvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkey
ktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe

SCOPe Domain Coordinates for d4ldfa_:

Click to download the PDB-style file with coordinates for d4ldfa_.
(The format of our PDB-style files is described here.)

Timeline for d4ldfa_: