Class a: All alpha proteins [46456] (284 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (4 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [224846] (1 PDB entry) |
Domain d4ldfa_: 4ldf A: [224654] automated match to d1e6ia_ complexed with gol, unx |
PDB Entry: 4ldf (more details), 2 Å
SCOPe Domain Sequences for d4ldfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ldfa_ a.29.2.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]} kvdlsmndqiwqlldtlsrhenawpfrkpvsigeasdyyeiikeptdiqtmkrkaknkey ktlsefsselkrmfdncrfynakntiytkyanqleafiwpmlqtiqe
Timeline for d4ldfa_: