Lineage for d4lc8b_ (4lc8 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1337250Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1337330Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1337470Protein automated matches [190130] (11 species)
    not a true protein
  7. 1337561Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (66 PDB entries)
  8. 1337570Domain d4lc8b_: 4lc8 B: [224651]
    automated match to d3li0b_
    complexed with bmp, cl, edo, mg; mutant

Details for d4lc8b_

PDB Entry: 4lc8 (more details), 1.32 Å

PDB Description: Crystal structure of the mutant H128N of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with the inhibitor BMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4lc8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc8b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsn
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdll

SCOPe Domain Coordinates for d4lc8b_:

Click to download the PDB-style file with coordinates for d4lc8b_.
(The format of our PDB-style files is described here.)

Timeline for d4lc8b_: