Lineage for d1ctma1 (1ctm A:1-167,A:231-250)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768468Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) (S)
  5. 2768469Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein)
  6. 2768470Protein Cytochrome f, large domain [49443] (5 species)
    this domain is interrupted by a small domain which is barrel-sandwich hybrid fold
  7. 2768495Species Turnip (Brassica rapa) [TaxId:3711] [49444] (2 PDB entries)
  8. 2768497Domain d1ctma1: 1ctm A:1-167,A:231-250 [22465]
    Other proteins in same PDB: d1ctma2
    complexed with hec

Details for d1ctma1

PDB Entry: 1ctm (more details), 2.3 Å

PDB Description: crystal structure of chloroplast cytochrome f reveals a novel cytochrome fold and unexpected heme ligation
PDB Compounds: (A:) cytochrome f

SCOPe Domain Sequences for d1ctma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctma1 b.2.6.1 (A:1-167,A:231-250) Cytochrome f, large domain {Turnip (Brassica rapa) [TaxId: 3711]}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnXpnvggfgqgdae
ivlqdplr

SCOPe Domain Coordinates for d1ctma1:

Click to download the PDB-style file with coordinates for d1ctma1.
(The format of our PDB-style files is described here.)

Timeline for d1ctma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ctma2