Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (66 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [226753] (1 PDB entry) |
Domain d4lc3b_: 4lc3 B: [224645] automated match to d1mdza_ complexed with cit, edo, gol |
PDB Entry: 4lc3 (more details), 1.6 Å
SCOPe Domain Sequences for d4lc3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lc3b_ c.67.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg dvrrvvdavnqiceqygk
Timeline for d4lc3b_: