Lineage for d4lc3b_ (4lc3 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381046Species Burkholderia cenocepacia [TaxId:216591] [226753] (1 PDB entry)
  8. 1381048Domain d4lc3b_: 4lc3 B: [224645]
    automated match to d1mdza_
    complexed with cit, edo, gol

Details for d4lc3b_

PDB Entry: 4lc3 (more details), 1.6 Å

PDB Description: X-ray crystal structure of a putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from Burkholderia cenocepacia
PDB Compounds: (B:) Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase

SCOPe Domain Sequences for d4lc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc3b_ c.67.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl
eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr
tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha
nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg
qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit
raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg
dvrrvvdavnqiceqygk

SCOPe Domain Coordinates for d4lc3b_:

Click to download the PDB-style file with coordinates for d4lc3b_.
(The format of our PDB-style files is described here.)

Timeline for d4lc3b_: