SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lc3b_ (4lc3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (108 species)
    not a true protein
  7. 2132337Species Burkholderia cenocepacia [TaxId:216591] [226753] (1 PDB entry)
  8. 2132339Domain d4lc3b_: 4lc3 B: [224645]
    automated match to d1mdza_
    complexed with cit, edo, gol

Details for d4lc3b_

PDB Entry: 4lc3 (more details), 1.6 Å

PDB Description: X-ray crystal structure of a putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from Burkholderia cenocepacia
PDB Compounds: (B:) Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase

SCOPe Domain Sequences for d4lc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc3b_ c.67.1.0 (B:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl
eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr
tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha
nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg
qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit
raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg
dvrrvvdavnqiceqygk

SCOPe Domain Coordinates for d4lc3b_:

Click to download the PDB-style file with coordinates for d4lc3b_.
(The format of our PDB-style files is described here.)

Timeline for d4lc3b_: