Lineage for d4lc3a_ (4lc3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896845Species Burkholderia cenocepacia [TaxId:216591] [226753] (1 PDB entry)
  8. 2896846Domain d4lc3a_: 4lc3 A: [224644]
    automated match to d1mdza_
    complexed with cit, edo, gol

Details for d4lc3a_

PDB Entry: 4lc3 (more details), 1.6 Å

PDB Description: X-ray crystal structure of a putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from Burkholderia cenocepacia
PDB Compounds: (A:) Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase

SCOPe Domain Sequences for d4lc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lc3a_ c.67.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl
eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr
tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha
nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg
qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit
raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg
dvrrvvdavnqiceqygk

SCOPe Domain Coordinates for d4lc3a_:

Click to download the PDB-style file with coordinates for d4lc3a_.
(The format of our PDB-style files is described here.)

Timeline for d4lc3a_: