Lineage for d1hcz_1 (1hcz 1-167,231-250)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) 
Superfamily b.2.6: Cytochrome f, large domain [49441] (1 family) 
Family b.2.6.1: Cytochrome f, large domain [49442] (1 protein) Protein Cytochrome f, large domain [49443] (3 species) 
Species Turnip (Brassica rapa) [TaxId:3711] [49444] (2 PDB entries) 
Domain d1hcz_1: 1hcz 1-167,231-250 [22464]
Other proteins in same PDB: d1hcz_2
Details for d1hcz_1
PDB Entry: 1hcz (more details), 1.96 Å
PDB Description: lumen-side domain of reduced cytochrome f at-35 degrees celsius
SCOP Domain Sequences for d1hcz_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcz_1 b.2.6.1 (1-167,231-250) Cytochrome f, large domain {Turnip (Brassica rapa)}
ypifaqqnyenpreatgrivcanchlaskpvdievpqavlpdtvfeavvkipydmqlkqv
langkkgalnvgavlilpegfelappdrispemkekignlsfqnyrpnkknilvigpvpg
qkyseitfpilapdpatnkdvhflkypiyvggnrgrgqiypdgsksnXpnvggfgqgdae
ivlqdplr
SCOP Domain Coordinates for d1hcz_1:
Click to download the PDB-style file with coordinates for d1hcz_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hcz_1:
- d1hcz_1 appears in SCOP 1.57
- d1hcz_1 appears in the current release, SCOPe 2.08, called d1hcza1
View in 3D
