Lineage for d4lbha_ (4lbh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950158Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2950159Protein automated matches [190081] (33 species)
    not a true protein
  7. 2950203Species Burkholderia cepacia [TaxId:292] [224930] (3 PDB entries)
  8. 2950204Domain d4lbha_: 4lbh A: [224636]
    automated match to d1mwqa_
    complexed with peg

Details for d4lbha_

PDB Entry: 4lbh (more details), 1.75 Å

PDB Description: 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (TftG) from Burkholderia phenoliruptrix AC1100: Apo-form
PDB Compounds: (A:) 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (TftG)

SCOPe Domain Sequences for d4lbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbha_ d.58.4.0 (A:) automated matches {Burkholderia cepacia [TaxId: 292]}
mlfliyrkdrpgslqvridnyaahlayleplkakiqvggptlgagtgtddkdmtgsflim
eaeswdevhsfvendpftkaglfaativerwkhg

SCOPe Domain Coordinates for d4lbha_:

Click to download the PDB-style file with coordinates for d4lbha_.
(The format of our PDB-style files is described here.)

Timeline for d4lbha_: