SCOPe 2.05: Domain d4lb2a3: 4lb2 A:389-582

Lineage for d4lb2a3 (4lb2 A:389-582)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (70 PDB entries)
   Uniprot P02768 29-596

8. Domain d4lb2a3: 4lb2 A:389-582 [224627]
   automated match to d1n5ua3
   complexed with dm5

Details for d4lb2a3

PDB Entry: 4lb2, 2.8 Å

PDB Description: X-ray study of human serum albumin complexed with idarubicin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d4lb2a3:

Sequence; same for both SEQRES and ATOM records:

>d4lb2a3 a.126.1.1 (A:389-582) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaasqaa

Timeline for d4lb2a3:

• d4lb2a3 first appeared in SCOPe 2.03
  
• d4lb2a3 appears in SCOPe 2.04
  
• d4lb2a3 appears in SCOPe 2.06
  
• d4lb2a3 appears in the current release, SCOPe 2.08