Lineage for d4laya1 (4lay A:22-140)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheetSuperfamily d.26.1: FKBP-like [54534] (4 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) 
Protein FKBP52, N-terminal domains [82619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82620] (11 PDB entries)
Uniprot Q02790 21-427; contains tandem repeat of two FKPB domains
Domain d4laya1: 4lay A:22-140 [224621]
automated match to d1q1ca1
complexed with i63
Details for d4laya1
PDB Entry: 4lay (more details), 1.7 Å
PDB Description: Crystal Structure Analysis of FKBP52, Complex with I63
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP4SCOPe Domain Sequences for d4laya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4laya1 d.26.1.1 (A:22-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
gvdispkqdegvlkvikregtgtempmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiaiatmkvgevchitckpeyaygsagsppkippnatlvfevelfefkge
SCOPe Domain Coordinates for d4laya1:
Click to download the PDB-style file with coordinates for d4laya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4laya1:
- d4laya1 first appeared in SCOPe 2.03
- d4laya1 appears in SCOPe 2.07
View in 3D
