Lineage for d4lada_ (4lad A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1406947Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1407111Protein automated matches [190124] (12 species)
    not a true protein
  7. 1407121Species Human (Homo sapiens) [TaxId:9606] [186848] (19 PDB entries)
  8. 1407150Domain d4lada_: 4lad A: [224619]
    automated match to d3fsha_
    complexed with oxl, zn

Details for d4lada_

PDB Entry: 4lad (more details), 2.3 Å

PDB Description: crystal structure of the ube2g2:ring-g2br complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 G2

SCOPe Domain Sequences for d4lada_:

Sequence, based on SEQRES records: (download)

>d4lada_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfpl
dyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekills
vvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl

Sequence, based on observed residues (ATOM records): (download)

>d4lada_ d.20.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfpl
dyplsppkmrftcemfhpniypdgrvcisilhapsaerwspvqsvekillsvvsmlaepn
desganvdaskmwrddreqfykiakqivqkslgl

SCOPe Domain Coordinates for d4lada_:

Click to download the PDB-style file with coordinates for d4lada_.
(The format of our PDB-style files is described here.)

Timeline for d4lada_: