Lineage for d4laaa_ (4laa A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540030Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1540031Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1540239Protein automated matches [190761] (1 species)
    not a true protein
  7. 1540240Species Staphylococcus aureus [TaxId:1280] [188650] (40 PDB entries)
  8. 1540250Domain d4laaa_: 4laa A: [224618]
    automated match to d3lx0a_
    complexed with ca, thp

Details for d4laaa_

PDB Entry: 4laa (more details), 1.58 Å

PDB Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS L36H at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d4laaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4laaa_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrhllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d4laaa_:

Click to download the PDB-style file with coordinates for d4laaa_.
(The format of our PDB-style files is described here.)

Timeline for d4laaa_: