| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
| Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
| Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries) Uniprot P02768 29-596 |
| Domain d4la0b1: 4la0 B:3-196 [224615] automated match to d1n5ua1 complexed with 198 |
PDB Entry: 4la0 (more details), 2.4 Å
SCOPe Domain Sequences for d4la0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4la0b1 a.126.1.1 (B:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq
Timeline for d4la0b1: