Class b: All beta proteins [48724] (177 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.5: STAT DNA-binding domain [81317] (3 proteins) |
Protein STAT3b [49437] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49438] (1 PDB entry) |
Domain d1bg1a2: 1bg1 A:322-575 [22461] Other proteins in same PDB: d1bg1a1, d1bg1a3 protein/DNA complex |
PDB Entry: 1bg1 (more details), 2.25 Å
SCOPe Domain Sequences for d1bg1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgs rkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitf etevyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtw dqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsf wvwldniidlvkky
Timeline for d1bg1a2: