SCOPe 2.06: Domain d1bg1a2: 1bg1 A:322-575

Lineage for d1bg1a2 (1bg1 A:322-575)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.5: STAT DNA-binding domain [81317] (3 proteins)

6. Protein STAT3b [49437] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49438] (1 PDB entry)

8. Domain d1bg1a2: 1bg1 A:322-575 [22461]
   Other proteins in same PDB: d1bg1a1, d1bg1a3
   protein/DNA complex

Details for d1bg1a2

PDB Entry: 1bg1, 2.25 Å

PDB Description: transcription factor stat3b/dna complex

PDB Compounds: (A:) protein (transcription factor stat3b)

SCOPe Domain Sequences for d1bg1a2:

Sequence; same for both SEQRES and ATOM records:

>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}
vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgs
rkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitf
etevyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtw
dqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsf
wvwldniidlvkky

Timeline for d1bg1a2:

• d1bg1a2 first appeared (with stable ids) in SCOP 1.55
  
• d1bg1a2 appears in SCOPe 2.05
  
• d1bg1a2 appears in SCOPe 2.07
  
• d1bg1a2 appears in the current release, SCOPe 2.08