Lineage for d1bg1a2 (1bg1 A:322-575)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659309Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 659552Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 659688Family b.2.5.5: STAT DNA-binding domain [81317] (3 proteins)
  6. 659696Protein STAT3b [49437] (1 species)
  7. 659697Species Mouse (Mus musculus) [TaxId:10090] [49438] (1 PDB entry)
  8. 659698Domain d1bg1a2: 1bg1 A:322-575 [22461]
    Other proteins in same PDB: d1bg1a1, d1bg1a3
    protein/DNA complex

Details for d1bg1a2

PDB Entry: 1bg1 (more details), 2.25 Å

PDB Description: transcription factor stat3b/dna complex
PDB Compounds: (A:) protein (transcription factor stat3b)

SCOP Domain Sequences for d1bg1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bg1a2 b.2.5.5 (A:322-575) STAT3b {Mouse (Mus musculus) [TaxId: 10090]}
vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgs
rkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitf
etevyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtw
dqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsf
wvwldniidlvkky

SCOP Domain Coordinates for d1bg1a2:

Click to download the PDB-style file with coordinates for d1bg1a2.
(The format of our PDB-style files is described here.)

Timeline for d1bg1a2: