![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (1 family) ![]() |
![]() | Family b.2.5.1: p53-like transcription factors [49418] (10 proteins) |
![]() | Protein STAT3b [49437] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49438] (1 PDB entry) |
![]() | Domain d1bg1a2: 1bg1 A:322-575 [22461] Other proteins in same PDB: d1bg1a1, d1bg1a3 |
PDB Entry: 1bg1 (more details), 2.25 Å
SCOP Domain Sequences for d1bg1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bg1a2 b.2.5.1 (A:322-575) STAT3b {Mouse (Mus musculus)} vverqpcmpmhpdrplviktgvqfttkvrllvkfpelnyqlkikvcidkdsgdvaalrgs rkfnilgtntkvmnmeesnngslsaefkhltlreqrcgnggrancdaslivteelhlitf etevyhqglkidlethslpvvvisnicqmpnawasilwynmltnnpknvnfftkppigtw dqvaevlswqfssttkrglsieqlttlaekllgpgvnysgcqitwakfckenmagkgfsf wvwldniidlvkky
Timeline for d1bg1a2: