SCOPe 2.03: Domain d4l8ea2: 4l8e A:92-209

Lineage for d4l8ea2 (4l8e A:92-209)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Xenorhabdus nematophila [TaxId:406817] [226706] (1 PDB entry)

8. Domain d4l8ea2: 4l8e A:92-209 [224596]
   Other proteins in same PDB: d4l8ea1
   automated match to d1k0db1
   complexed with cl, gsh, mes

Details for d4l8ea2

PDB Entry: 4l8e, 1.7 Å

PDB Description: Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit

PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4l8ea2:

Sequence; same for both SEQRES and ATOM records:

>d4l8ea2 a.45.1.0 (A:92-209) automated matches {Xenorhabdus nematophila [TaxId: 406817]}
lskdtrerteqlqwlfwqvagfgpmlgqnhhfnryapevvpyaikryteesqrlykvlnt
qlektpylggneysiadiavypwakcyehqkinledypavkkwlekiqqrpatqaayn

Timeline for d4l8ea2:

• d4l8ea2 is new in SCOPe 2.03-stable
  
• d4l8ea2 appears in SCOPe 2.04
  
• d4l8ea2 appears in the current release, SCOPe 2.08