Lineage for d4l8ea2 (4l8e A:92-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714333Species Xenorhabdus nematophila [TaxId:406817] [226706] (1 PDB entry)
  8. 2714334Domain d4l8ea2: 4l8e A:92-209 [224596]
    Other proteins in same PDB: d4l8ea1
    automated match to d1k0db1
    complexed with cl, gsh, mes

Details for d4l8ea2

PDB Entry: 4l8e (more details), 1.7 Å

PDB Description: Crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit
PDB Compounds: (A:) Glutathione S-transferase enzyme with thioredoxin-like domain

SCOPe Domain Sequences for d4l8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l8ea2 a.45.1.0 (A:92-209) automated matches {Xenorhabdus nematophila [TaxId: 406817]}
lskdtrerteqlqwlfwqvagfgpmlgqnhhfnryapevvpyaikryteesqrlykvlnt
qlektpylggneysiadiavypwakcyehqkinledypavkkwlekiqqrpatqaayn

SCOPe Domain Coordinates for d4l8ea2:

Click to download the PDB-style file with coordinates for d4l8ea2.
(The format of our PDB-style files is described here.)

Timeline for d4l8ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l8ea1