Lineage for d4l83a_ (4l83 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898507Protein automated matches [190124] (12 species)
    not a true protein
  7. 1898607Species Nematode (Brugia malayi) [TaxId:6279] [226704] (1 PDB entry)
  8. 1898608Domain d4l83a_: 4l83 A: [224594]
    automated match to d1u9ba_
    complexed with edo

Details for d4l83a_

PDB Entry: 4l83 (more details), 1.7 Å

PDB Description: Structure of a putative Ubiquitin-conjugating enzyme E2 from Brugia malayi
PDB Compounds: (A:) Ube2i2 protein

SCOPe Domain Sequences for d4l83a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l83a_ d.20.1.1 (A:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]}
giaagrlaeerkawrknhpfgfiakpssnpdgtrnlfiwecaipgkkgtiwegglykirm
qfkddypstppkckfdpplfhpnvypsgtvclsildenkdwkpsisvrqlligiqdlltn
pnvddpaqadayqiycqnrveyekrvrrqaqqfsaeivqrqmldn

SCOPe Domain Coordinates for d4l83a_:

Click to download the PDB-style file with coordinates for d4l83a_.
(The format of our PDB-style files is described here.)

Timeline for d4l83a_: