SCOPe 2.06: Domain d4l82b1: 4l82 B:1-160

Lineage for d4l82b1 (4l82 B:1-160)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Rickettsia felis [TaxId:315456] [226703] (1 PDB entry)

8. Domain d4l82b1: 4l82 B:1-160 [224591]
   Other proteins in same PDB: d4l82b2
   automated match to d3cb0b_
   complexed with cl, fmn, scn

Details for d4l82b1

PDB Entry: 4l82, 2 Å

PDB Description: Structure of a putative oxidoreductase from Rickettsia felis

PDB Compounds: (B:) RifeA.00250.a

SCOPe Domain Sequences for d4l82b1:

Sequence; same for both SEQRES and ATOM records:

>d4l82b1 b.45.1.0 (B:1-160) automated matches {Rickettsia felis [TaxId: 315456]}
magtvtesqfkdtmsrfpqgvtiittncnnelfgftassltsvslkpplilfclnknsfs
insfqksdkfavsilaenqidiskhfaksqpnkftkiayelgnktncplingatcyiecn
kyasydagdhvifigevintaikndlkpllyfhksytnlq

Timeline for d4l82b1:

• d4l82b1 first appeared in SCOPe 2.03, called d4l82b_
  
• d4l82b1 was called d4l82b_ in SCOPe 2.05
  
• d4l82b1 appears in SCOPe 2.07
  
• d4l82b1 appears in the current release, SCOPe 2.08