Class b: All beta proteins [48724] (180 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.0: automated matches [191365] (1 protein) not a true family |
Protein automated matches [190439] (22 species) not a true protein |
Species Rickettsia felis [TaxId:315456] [226703] (1 PDB entry) |
Domain d4l82b1: 4l82 B:1-160 [224591] Other proteins in same PDB: d4l82b2 automated match to d3cb0b_ complexed with cl, fmn, scn |
PDB Entry: 4l82 (more details), 2 Å
SCOPe Domain Sequences for d4l82b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l82b1 b.45.1.0 (B:1-160) automated matches {Rickettsia felis [TaxId: 315456]} magtvtesqfkdtmsrfpqgvtiittncnnelfgftassltsvslkpplilfclnknsfs insfqksdkfavsilaenqidiskhfaksqpnkftkiayelgnktncplingatcyiecn kyasydagdhvifigevintaikndlkpllyfhksytnlq
Timeline for d4l82b1: