Lineage for d1xbrb_ (1xbr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768316Family b.2.5.4: T-box [81316] (3 proteins)
    automatically mapped to Pfam PF00907
  6. 2768317Protein T domain from Brachyury transcription factor [49433] (1 species)
  7. 2768318Species African clawed frog (Xenopus laevis) [TaxId:8355] [49434] (1 PDB entry)
  8. 2768320Domain d1xbrb_: 1xbr B: [22459]
    protein/DNA complex

Details for d1xbrb_

PDB Entry: 1xbr (more details), 2.5 Å

PDB Description: t domain from xenopus laevis bound to dna
PDB Compounds: (B:) protein (t protein)

SCOPe Domain Sequences for d1xbrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbrb_ b.2.5.4 (B:) T domain from Brachyury transcription factor {African clawed frog (Xenopus laevis) [TaxId: 8355]}
elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
ker

SCOPe Domain Coordinates for d1xbrb_:

Click to download the PDB-style file with coordinates for d1xbrb_.
(The format of our PDB-style files is described here.)

Timeline for d1xbrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xbra_