Lineage for d4l7kk_ (4l7k K:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1405093Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1405183Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 1405184Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1405185Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (21 PDB entries)
  8. 1405245Domain d4l7kk_: 4l7k K: [224584]
    automated match to d3mkia_
    complexed with gol, so4

Details for d4l7kk_

PDB Entry: 4l7k (more details), 2.1 Å

PDB Description: Crystal Structure of Ketosteroid Isomerase D38E from Pseudomonas Testosteroni (tKSI)
PDB Compounds: (K:) steroid delta-isomerase

SCOPe Domain Sequences for d4l7kk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7kk_ d.17.4.3 (K:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
lplaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekn
iha

SCOPe Domain Coordinates for d4l7kk_:

Click to download the PDB-style file with coordinates for d4l7kk_.
(The format of our PDB-style files is described here.)

Timeline for d4l7kk_: