SCOPe 2.05: Domain d1xbra_: 1xbr A:

Lineage for d1xbra_ (1xbr A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.4: T-box [81316] (3 proteins)
   automatically mapped to Pfam PF00907

6. Protein T domain from Brachyury transcription factor [49433] (1 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [49434] (1 PDB entry)

8. Domain d1xbra_: 1xbr A: [22458]
   protein/DNA complex

Details for d1xbra_

PDB Entry: 1xbr, 2.5 Å

PDB Description: t domain from xenopus laevis bound to dna

PDB Compounds: (A:) protein (t protein)

SCOPe Domain Sequences for d1xbra_:

Sequence; same for both SEQRES and ATOM records:

>d1xbra_ b.2.5.4 (A:) T domain from Brachyury transcription factor {African clawed frog (Xenopus laevis) [TaxId: 8355]}
elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
kern

Timeline for d1xbra_:

• d1xbra_ first appeared (with stable ids) in SCOP 1.55
  
• d1xbra_ appears in SCOPe 2.04
  
• d1xbra_ appears in SCOPe 2.06
  
• d1xbra_ appears in the current release, SCOPe 2.08