Lineage for d4l7kb_ (4l7k B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162085Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 protein domains)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2162086Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 2162087Species Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId:285] [54436] (23 PDB entries)
  8. 2162132Domain d4l7kb_: 4l7k B: [224575]
    automated match to d3mkia_
    complexed with gol, so4

Details for d4l7kb_

PDB Entry: 4l7k (more details), 2.1 Å

PDB Description: Crystal Structure of Ketosteroid Isomerase D38E from Pseudomonas Testosteroni (tKSI)
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d4l7kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l7kb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]}
mntpehmtavvqryvaalnagdldgivalfaddatveepvgseprsgtaairefyanslk
lplaveltqevravaneaafaftvsfeyqgrktvvapidhfrfngagkvvsmralfgekn
iha

SCOPe Domain Coordinates for d4l7kb_:

Click to download the PDB-style file with coordinates for d4l7kb_.
(The format of our PDB-style files is described here.)

Timeline for d4l7kb_: