![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
![]() | Protein automated matches [191197] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225406] (21 PDB entries) |
![]() | Domain d4l6sb2: 4l6s B:797-1011 [224572] Other proteins in same PDB: d4l6sa1, d4l6sb1 automated match to d1gs0a2 protein/DNA complex; complexed with 1wq |
PDB Entry: 4l6s (more details), 2.2 Å
SCOPe Domain Sequences for d4l6sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l6sb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d4l6sb2: